PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.6G187000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 361aa    MW: 37638.5 Da    PI: 6.9223
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.6G187000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.51.7e-14282333556
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++ N +L+k+ +e+ ++ 
  Sevir.6G187000.1.p 282 RRQRRMIKNRESAARSRARKQAYTMELEAEVQKLKELNAELQKKQDEMMEMQ 333
                         79******************************************99999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-13278342IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.875280331IPR004827Basic-leucine zipper domain
CDDcd147073.05E-26282336No hitNo description
PfamPF001709.3E-13282334IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-10282332No hitNo description
Gene3DG3DSA:1.20.5.1709.3E-15282331No hitNo description
PROSITE patternPS000360285300IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MDLKDGERRG AAGPGPLSRQ GSIYSLTFDE FQSTLGGMGG GLGKDFGSMN MDELLRSIWT  60
AEESQAMASA SAAASASAAG AAGEDGAALQ RQGSLTLPRT LSVKTVDEVW RDFVREGPAP  120
GAAGGGAEPQ PNRQPTLGEM TLEEFLVRAG VVRDNPTAAA MAAAAAVPAQ PVAPRPIQAV  180
SNGASIFFGN FGAANDAGTG AMGFAPVGIG DQAMGNGLMP GVAGISSAAV TVSPVDTSVA  240
QLDSVGNGNG DLSSPMAPVP YPFEGVIRGR RSGAGVEKVV ERRQRRMIKN RESAARSRAR  300
KQAYTMELEA EVQKLKELNA ELQKKQDEMM EMQKNQVLEV VSNPYAQKKR CLRRTLTGPW  360
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973666.10.0PREDICTED: bZIP transcription factor TRAB1
SwissprotQ6ZDF31e-135TRAB1_ORYSJ; bZIP transcription factor TRAB1
TrEMBLK3YIB00.0K3YIB0_SETIT; Uncharacterized protein
STRINGSi013904m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP70638147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.19e-72abscisic acid responsive element-binding factor 1